SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048528 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048528
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.13e-134
Family Myotubularin-like phosphatases 0.0000000507
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-19
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048528   Gene: ENSPTRG00000019986   Transcript: ENSPTRT00000037036
Sequence length 549
Comment pep:known scaffold:CHIMP2.1.4:GL390916.1:3175473:3219777:1 gene:ENSPTRG00000019986 transcript:ENSPTRT00000037036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNL
VIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELE
TEDGMQESP
Download sequence
Identical sequences H2R5W3 Q96QG7
ENSP00000221086 ENSPTRP00000048528 NP_056273.2.87134 NP_056273.2.92137 XP_001138621.1.37143 XP_003805372.1.60992 ENSP00000221086 ENSPTRP00000048528 gi|19923424|ref|NP_056273.2| ENSP00000221086 9598.ENSPTRP00000048528 9606.ENSP00000221086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]