SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053686 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053686
Domain Number 1 Region: 392-521
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-41
Family PLC-like (P variant) 0.0012
Further Details:      
 
Domain Number 2 Region: 216-380
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-39
Family Dual specificity phosphatase-like 0.0000109
Further Details:      
 
Domain Number 3 Region: 74-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000369
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053686   Gene: ENSPTRG00000005671   Transcript: ENSPTRT00000010459
Sequence length 522
Comment pep:known chromosome:CHIMP2.1.4:13:18946538:19022057:-1 gene:ENSPTRG00000005671 transcript:ENSPTRT00000010459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESPQTSEFKGTTEEAPAKESPHTSEFKGAARVSPISKRMLERLSKFEVGDAENVASYD
SKSKKIVHSIVSSFAFGIFGVFLVLLDVTLLLADLIFTDSKLYIPLEYRSISLAIGLFFL
MDVLLRVFVEGRQQYFSDLFNILDTAIIVIPLLVDVIYIFFDIKLLRNIPRWTHLVRLLR
LIILIRIFHLLHQKRQLEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQS
FYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVSRIMIDDHNVPTLHEMVVF
TKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTDKTH
SNKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGDVCDLKVQVVME
KKVVFSSTSLGNCSILHDTESDKVLINVYDGPPVYDDVKVQFFSSNLPKYYDNCPFFFWF
NTSFIQNNRLCLPRNELDNPHKQKAWKIYPPEFAVEILFGEK
Download sequence
Identical sequences A0A2I3TTX9
ENSPTRP00000053686 ENSPTRP00000053686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]