SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053850 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053850
Domain Number 1 Region: 119-417
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.31e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053850   Gene: ENSPTRG00000002476   Transcript: ENSPTRT00000060459
Sequence length 420
Comment pep:known scaffold:CHIMP2.1.4:GL391668.1:465797:536453:-1 gene:ENSPTRG00000002476 transcript:ENSPTRT00000060459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRDFRAESVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVS
EGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF
QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRT
GVFLCVDVVFCAIVKNCSFNIMEIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
Download sequence
Identical sequences 9598.ENSPTRP00000053850 ENSPTRP00000053850 ENSPTRP00000053850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]