SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059267 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059267
Domain Number 1 Region: 21-186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-32
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059267   Gene: ENSPTRG00000033944   Transcript: ENSPTRT00000067681
Sequence length 201
Comment pep:known chromosome:CHIMP2.1.4:11:47709851:47717942:1 gene:ENSPTRG00000033944 transcript:ENSPTRT00000067681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITARATKDGTFDISKT
Download sequence
Identical sequences H2RDS5
XP_003313059.1.37143 ENSPTRP00000059267 ENSPTRP00000059267 9598.ENSPTRP00000059267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]