SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060401 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060401
Domain Number 1 Region: 152-293
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-29
Family Dual specificity phosphatase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 9-139
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.09e-17
Family Cell cycle control phosphatase, catalytic domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060401   Gene: ENSPTRG00000041595   Transcript: ENSPTRT00000073624
Sequence length 598
Comment pep:known chromosome:CHIMP2.1.4:10:72308647:72310471:1 gene:ENSPTRG00000041595 transcript:ENSPTRT00000073624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKMMDAKKLASLLRGGPRVLVIYSRSFEYNSWHVLSSVNICCSKLVKWRLQKG
KVTIAEFIWLATRSQVEATEPQDVVVYDQSTRDASVLAADRFLSILLSKLDSCFDSVAIL
TGGFATFSSCFPSLCQGKPAALLPMSLSQPCLPVPSVSLTLILPHLYLGSQKDVLNKDLT
TQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWLDKSMEFICKGKLSSCQV
IVHCLVGISHSATIAIAYIMKTMGISSDDTYRFMKDRRQSISPNFNFLGQLLEERSLKLL
ATVQGDAGTPSGTPEPPPSPAAGARLPWLPPPTSESAATGSAAAREGGLSAGGEPPLPPT
PPDTCVLQQGLRGLYLSSDRLQDTNRLKRSFSLYIKSANTPGRRPNGPGSPDPGEVPKLC
KLHGPSETLSLPSPSPDSPDAARPRPCGRPRPPAGSSPAHSLGLSALSAPRLPGPGQPAG
VWAPPLDSPGTPSPDGPCFSPEGAQGAGGVLFAPFGRAGAPGRGGGSDLRRPEAARAEPR
DARTSWPDEPPPQTQIKRCSCQMEFEEGILEGRTRGEELAAMGKQASFSGSVEVIEMS
Download sequence
Identical sequences ENSPTRP00000060401 ENSPTRP00000060401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]