SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060466 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000060466
Domain Number - Region: 5-57
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0936
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060466   Gene: ENSPTRG00000042197   Transcript: ENSPTRT00000072973
Sequence length 62
Comment pep:novel scaffold:CHIMP2.1.4:GL390916.1:2948804:2953257:-1 gene:ENSPTRG00000042197 transcript:ENSPTRT00000072973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKENRELPVGEFQYDVWKGHSVPLTSHWLELRRMATLIAKEAGRWGWLCAQGKERTISV
ST
Download sequence
Identical sequences ENSPTRP00000060466 ENSPTRP00000060466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]