SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060873 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060873
Domain Number 1 Region: 11-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-37
Family Dual specificity phosphatase-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060873   Gene: ENSPTRG00000041351   Transcript: ENSPTRT00000076188
Sequence length 190
Comment pep:known chromosome:CHIMP2.1.4:X:45312622:45313504:1 gene:ENSPTRG00000041351 transcript:ENSPTRT00000076188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANNKLLLSSNRITAIVNASVEVVN
VFFEGIQYIKVPVTDARDSRLYDFFDPIADLIYTIDMRQGRTLLHCMAGVSRSASLCLAY
LMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIY
EKDLRTMIST
Download sequence
Identical sequences H2RH74
XP_003317482.1.37143 XP_003808417.1.60992 XP_016803011.1.37143 ENSPTRP00000060873 ENSPTRP00000060873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]