SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000818 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000818
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-40
Family Dual specificity phosphatase-like 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000818   Gene: ENSPTRG00000000467   Transcript: ENSPTRT00000000915
Sequence length 167
Comment pep:known chromosome:CHIMP2.1.4:1:32036531:32047723:-1 gene:ENSPTRG00000000467 transcript:ENSPTRT00000000915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLFRVCDATYEKAPVEKEGN
HVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECG
MKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Download sequence
Identical sequences ENSPTRP00000000818 ENSPTRP00000000818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]