SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020344 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020344
Domain Number 1 Region: 14-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.08e-118
Family Aldose 1-epimerase (mutarotase) 0.0000000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020344   Gene: ENSPTRG00000011850   Transcript: ENSPTRT00000022052
Sequence length 342
Comment pep:known chromosome:CHIMP2.1.4:2A:39225836:39301691:1 gene:ENSPTRG00000011850 transcript:ENSPTRT00000022052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN
GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWCKFSVA
Download sequence
Identical sequences H2QHS2
9598.ENSPTRP00000020344 ENSPTRP00000020344 ENSPTRP00000020344 XP_003817682.1.60992 XP_009440621.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]