SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026370 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026370
Domain Number 1 Region: 779-980
Classification Level Classification E-value
Superfamily Macro domain-like 3.53e-54
Family Macro domain 0.0000666
Further Details:      
 
Domain Number 2 Region: 1198-1398
Classification Level Classification E-value
Superfamily Macro domain-like 5.55e-45
Family Macro domain 0.001
Further Details:      
 
Domain Number 3 Region: 1012-1188
Classification Level Classification E-value
Superfamily Macro domain-like 3.2e-42
Family Macro domain 0.00018
Further Details:      
 
Domain Number 4 Region: 1621-1800
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.55e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.042
Further Details:      
 
Domain Number 5 Region: 1492-1601
Classification Level Classification E-value
Superfamily WWE domain 3.79e-20
Family WWE domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026370
Domain Number - Region: 225-287
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00274
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026370   Gene: ENSPTRG00000015297   Transcript: ENSPTRT00000028570
Sequence length 1801
Comment pep:known chromosome:CHIMP2.1.4:3:126061382:126112270:1 gene:ENSPTRG00000015297 transcript:ENSPTRT00000028570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYP
EDVRQKVLERKNHELVWQGKGTFKLTVQLPATPDEIHHVFEEELLTKESKTKEDVKEPDV
SEELDTKLPLDGGLDKMEDIPEECENISSLVAFENLKANVTDIMLILLVENISGLSNDDF
QVEIIRDFDVAVVTFQKHIDTIRFVDDCTKHHSIKQLQLSPRLLEVTNTIRVENLPPGAD
DYSLKLFFENPYNGGGRVANVEYFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPY
YASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQL
SGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVIPIKVDPTMWDTIKNDVKDD
RILIEFDTLKEMVILAGKSEDVQSIEVQVKELIESTTQKIKREEQSLKEKMIISPGKYFL
LCHSSLLDHLLTECPEIEICYYRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSP
EIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALSYKR
IEVENKEVLHGKKWKGLTHNLLKKQNSSPNTVIINELISETTAEVIITGCVKEVNETYKL
LFNFIEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKINKVNVQVSFNPENKQKGILLTGS
KTEVLKAVDIVKQVWDSVCVKSVHIDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEV
MKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLAQLPVDVVVNASNEDLKHYGGLAAALSKA
AGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRA
VQRSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLV
DVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVK
EDVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTS
SWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFP
KNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIP
KAKDTQGFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSK
AILECAGQNVEMECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEK
KNYSSICLPAIGTGNAKQYPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPEVLDVFY
ANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVE
YAISWLQDLIEKEQCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGI
SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFDKMTNLKLEDAR
REKKKTIDVKINHRHYTVNLNTYTATDAKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVV
KLLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL
FHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSASDTYSRPDANGRKHVYY
VRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFR
K
Download sequence
Identical sequences H2QN82
ENSPTRP00000026370 XP_516695.3.37143 ENSPTRP00000026370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]