SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029213 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029213
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029213   Gene: ENSPTRG00000017069   Transcript: ENSPTRT00000031624
Sequence length 306
Comment pep:known chromosome:CHIMP2.1.4:5:24888645:24902619:1 gene:ENSPTRG00000017069 transcript:ENSPTRT00000031624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCSDTDILEEDAEVYELRSRGKEKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSP
AAQQET
Download sequence
Identical sequences A0A2I3TLK8
9598.ENSPTRP00000029213 ENSPTRP00000029213 XP_003822823.1.60992 XP_016808498.1.37143 XP_517659.3.37143 ENSPTRP00000029213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]