SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030454 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030454
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Histone-fold 1.93e-57
Family Nucleosome core histones 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030454   Gene: ENSPTRG00000017860   Transcript: ENSPTRT00000032969
Sequence length 137
Comment pep:known chromosome:CHIMP2.1.4:6:28159541:28159954:-1 gene:ENSPTRG00000017860 transcript:ENSPTRT00000032969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKST
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVT
IMPKDIQLARRIRGERA
Download sequence
Identical sequences 9544.ENSMMUP00000001925 ENSMMUP00000001925 ENSMMUP00000001925 ENSPTRP00000030454 ENSPTRP00000030454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]