SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033528 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033528
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033528   Gene: ENSPTRG00000019581   Transcript: ENSPTRT00000036268
Sequence length 780
Comment pep:known chromosome:CHIMP2.1.4:7:109146940:109204244:1 gene:ENSPTRG00000019581 transcript:ENSPTRT00000036268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGGRSEPPQLPEYSCSYVVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKR
AFGVLKSLVPILEWLPKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFLVSSSNGTVLNTTMIDTAA
RDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QVAGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIE
EPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRAT
KNGIISDAGSTNNAFEPDEDIEDPEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFL
TVHDAILYLQNQVKSQKGQDSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Download sequence
Identical sequences H2QV81
ENSPTRP00000033528 ENSPTRP00000033528 XP_009452244.1.37143 9598.ENSPTRP00000033528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]