SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034416 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034416
Domain Number 1 Region: 417-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-78
Family Protein kinases, catalytic subunit 0.0000000454
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 9.42e-58
Family FAT domain of focal adhesion kinase 0.00000707
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-34
Family First domain of FERM 0.00035
Further Details:      
 
Domain Number 5 Region: 261-365
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-30
Family Third domain of FERM 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034416   Gene: ENSPTRG00000020104   Transcript: ENSPTRT00000037241
Sequence length 1009
Comment pep:known chromosome:CHIMP2.1.4:8:23617871:23752188:1 gene:ENSPTRG00000020104 transcript:ENSPTRT00000037241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHLRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNCILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences H2QVX8
XP_001163491.1.37143 XP_009453348.1.37143 XP_009453349.1.37143 XP_009453350.1.37143 XP_009453352.1.37143 XP_016814750.1.37143 XP_016814751.1.37143 XP_016814752.1.37143 XP_016814753.1.37143 9598.ENSPTRP00000034416 ENSPTRP00000034416 ENSPTRP00000034416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]