SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034727 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034727
Domain Number 1 Region: 122-287
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-50
Family CRAL/TRIO domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 23-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.19e-18
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034727   Gene: ENSPTRG00000020288   Transcript: ENSPTRT00000037574
Sequence length 354
Comment pep:known chromosome:CHIMP2.1.4:8:59027548:59244927:1 gene:ENSPTRG00000020288 transcript:ENSPTRT00000037574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPLLALD
Download sequence
Identical sequences H2QW80 Q8IUQ0
ENSP00000325506 ENSP00000428402 ENSP00000428174 gi|27734849|ref|NP_775790.1| ENSP00000325506 ENSP00000428402 NP_775790.1.87134 NP_775790.1.92137 XP_003805153.1.60992 XP_016815004.1.37143 XP_016868630.1.92137 XP_016868631.1.92137 XP_519783.2.37143 ENSPTRP00000034727 ENSPTRP00000034727 9598.ENSPTRP00000034727 9606.ENSP00000325506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]