SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044348 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044348
Domain Number 1 Region: 546-578,716-790
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000597
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044348   Gene: ENSPTRG00000018095   Transcript: ENSPTRT00000049352
Sequence length 969
Comment pep:known chromosome:CHIMP2.1.4:6:36395984:36479689:-1 gene:ENSPTRG00000018095 transcript:ENSPTRT00000049352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERSAISGFSSKSRRNSFTYDVKREVYNEETFQQEHKRKASTSGNMNINITTFRHHV
QCRCSWHRFLRCMLTVFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKVSPFNNGQLVMGSFVKN
EFSAPSYLMGYNKSLSVVATTTFLTGIIQLIMGVLGLGYIATYLPESAMSAYLAAVALHI
MLSQLTFIFGIMISFHAGPISFFYDIINYCVALPKANSTSILLFLTVVVALRINKCIRIS
FNQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLFPVTPDFSLLPKIILQ
AFSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAIARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYTLPNAVLAGIILSNVIPYLETISNLPSLW
RQDQYDCALWMMTFSSSIFLGLDIGLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYRS
INDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTS
LQGGKICRCFCNCDDLEPLPRILYTERFENKLDPEASSVNLIHCSHFESMNASQTASEDQ
VPYTVSSVSQKNQGQQEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLLPSV
HTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFERNDFFDAGITK
TQLFLSVHDAVLFALSRKVIGSSELNIDESETVIRETYSETDKNDNSRYKMSSSFLGSQK
NVSPGFIKIQQPVEEELELDLELESEQEAGLGLDLDLDRELEPEMEPKAETETKTQTEME
PQPETEPEMEPNPKSRPRAHTFLQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSYS
PEGNSNEDV
Download sequence
Identical sequences A0A2J8NZ29
9598.ENSPTRP00000044348 ENSPTRP00000044348 ENSPTRP00000044348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]