SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048464 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048464
Domain Number 1 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 45-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 432-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 163-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000011
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048464
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000209
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048464   Gene: ENSPTRG00000011569   Transcript: ENSPTRT00000021566
Sequence length 533
Comment pep:known chromosome:CHIMP2.1.4:19:62769877:62777698:-1 gene:ENSPTRG00000011569 transcript:ENSPTRT00000021566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELTDSARGCVVFEDVFVYFSR
EEWELLDDAQRLLYHDVMLENFALLASLGIAFSRSRAVMKLQRGEEPWVYDQVDMTSATE
REAQRGLRPGCWHGVEDEEVSSEQSIFVAGVSEVRTLVAELESHPCDICGPILKDTLHLA
KYYGGKARQKPYLCGACGKQFWFSTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKT
LTCGKGRRDFSATSGLLQHQASHSSMKPHKSTKLVSGFLMGQRYHRCGECGKAFTRKDTL
ARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHR
RVHTGERLYQCGKCGKFFSSKSNLIHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTG
ERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYEC
SKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL
Download sequence
Identical sequences ENSPTRP00000048464 ENSPTRP00000048464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]