SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048812 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048812
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 290-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 336-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000016
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048812
Domain Number - Region: 240-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00353
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048812   Gene: ENSPTRG00000024231   Transcript: ENSPTRT00000020021
Sequence length 615
Comment pep:known chromosome:CHIMP2.1.4:19:39931783:39941046:1 gene:ENSPTRG00000024231 transcript:ENSPTRT00000020021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLQYPECYLAPNRCLVSNCGVNKMSNEELVGQNHGMEGEACIGGDVTFNDVAIDFSHE
EWGWLNSAQRDLYKDVMVQNYENLVSVAGLSITKPYVITLLEDGKEPWMMEKKLSKGMIP
HWESRWENKELSTKKDIYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVD
HFRPAILTSRESPTADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKS
VIKHEKVNGGKKLLNSNKSGAAFSQGKSLTLPQTCNREKIYTCSECGKAFGKQSILNRHW
RIHTGEKPYECRECGKTFSHGSSLTRHLISHSGEKPYKCIECGKAFSHVSSLTNHQSTHT
GEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICGKAFIHRSSLIHHQKIHTGEKP
YECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQ
KCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYECIKCGK
TFSCSSNLTVHQRIHTGEKPYKCSECGKAFSKGSNLTAHQRVHNGEKPNSVVSVEKPLDY
MNHYTCEKSYRRETV
Download sequence
Identical sequences H2R670
ENSPTRP00000048812 ENSPTRP00000048812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]