SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001088 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001088
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.28e-40
Family Vertebrate phospholipase A2 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001088   Gene: ENSSARG00000001194   Transcript: ENSSART00000001185
Sequence length 135
Comment pep:known_by_projection scaffold:COMMON_SHREW1:scaffold_188332:1630:5074:-1 gene:ENSSARG00000001194 transcript:ENSSART00000001185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATTVDGLSTLNAQSIPQFGKMISCLIPSESKFNKYGCYCGIGGYGTPVDELDRCCLTHDN
CYGQAVKLGHCSSLLDHPYFKWYSYSCTKSKVVCSSKNNCEDFLCHCDLAAAICFSKVPY
NEEYKNLDRNKYCKP
Download sequence
Identical sequences ENSSARP00000001088 ENSSARP00000001088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]