SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001590 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001590
Domain Number 1 Region: 100-173
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.71e-19
Family Prokaryotic phospholipase A2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001590   Gene: ENSSARG00000001763   Transcript: ENSSART00000001750
Sequence length 195
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4490:246144:273603:-1 gene:ENSSARG00000001763 transcript:ENSSART00000001750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLASGFLVLCLSLGASRVQSDTSPEAEESYSDWGLRKLQGSFESVTSYFDSFQELLGGK
DGVCQYRCRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLADTVFNAVWTLGCRPFMNS
QRAACICAEEEREEL
Download sequence
Identical sequences ENSSARP00000001590 ENSSARP00000001590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]