SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004097 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004097
Domain Number 1 Region: 21-96
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.15e-27
Family Vertebrate phospholipase A2 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004097   Gene: ENSSARG00000004535   Transcript: ENSSART00000004509
Sequence length 96
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_143855:3684:4389:1 gene:ENSSARG00000004535 transcript:ENSSART00000004509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILLLAMIVAFGLLPTHGALWNFQKMIKKTTGKNAITNYGFYGCYCAVSGKGTPKDATD
RCCFAHDCCYRRLKRQGCGRKFLNYKVIYKNGKITC
Download sequence
Identical sequences ENSSARP00000004097 ENSSARP00000004097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]