SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007141 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007141
Domain Number 1 Region: 66-148
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 6.17e-21
Family Vertebrate phospholipase A2 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007141   Gene: ENSSARG00000007899   Transcript: ENSSART00000007889
Sequence length 171
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4629:18716:24515:1 gene:ENSSARG00000007899 transcript:ENSSART00000007889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SILGMKKFFTIALVAGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCCHAHDCCYQKLFDLGCHPYVDHYEYTIENNTITCNKVNTTECDQQTCECDKSV
VLCLQNQPYNEEYRNYLNIYCRGPTPNCSIYEPPPEFMACPPFWPGSPASP
Download sequence
Identical sequences ENSSARP00000007141 ENSSARP00000007141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]