SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007585 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007585
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily CutC-like 3.27e-47
Family CutC-like 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007585   Gene: ENSSARG00000008396   Transcript: ENSSART00000008385
Sequence length 250
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6877:217196:237621:1 gene:ENSSARG00000008396 transcript:ENSSART00000008385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AANGFLMEVCVDSVESAVNAERGGAGRIELCSSLLEGGTTPSMGVLQVVKQCVQIPVFVM
IRPRGGDFLYSDREVEVMKADIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICRPLP
VTFHRAFDMVHDPVAALETLLTLGFERVLTSGCDSSALEGLPVIKRLIDQAKGRIVVMPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPSVAMGASLSNSEYTLKVTDVAKV
RTLNAIAQNI
Download sequence
Identical sequences ENSSARP00000007585 ENSSARP00000007585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]