SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007645 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007645
Domain Number 1 Region: 357-425
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000000000295
Family Vertebrate phospholipase A2 0.0032
Further Details:      
 
Domain Number 2 Region: 76-115
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0000000845
Family Vertebrate phospholipase A2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007645   Gene: ENSSARG00000008455   Transcript: ENSSART00000008450
Sequence length 492
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2935:64848:118406:-1 gene:ENSSARG00000008455 transcript:ENSSART00000008450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALLFLSILTAPRAGGHTLDTPQLPRELSPGFSKDINVTFFNGVFKNVESVAEIFDCLG
SHFTWLQAVFTNFPVLLQFVNGMRCVAGLCPRDFEDYGCACRFEMEGLPVDETDXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFAKTSTDGQTTPP
RTXXXXXXXXXXXXXXXXXXXSAEIVVTVQGVSDVPTSTQSLSSAVSSVKGGPGKTTGRX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCF
SHHCCLKQVRRLGCLPERLPPSRVVCEDSTPKCVGQSLCAKLLCACDETAAQCMASAFFN
QSLKSSGRQQCGPPASCEDSVHGGASVPFLGSSSEEVSEEERPQAEGLRRTRRFLGNSLG
LKGTRPQYGPGQ
Download sequence
Identical sequences ENSSARP00000007645 ENSSARP00000007645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]