SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009382 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009382
Domain Number 1 Region: 390-621
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-25
Family RecA protein-like (ATPase-domain) 0.023
Further Details:      
 
Domain Number 2 Region: 234-331
Classification Level Classification E-value
Superfamily DNA primase core 0.0000107
Family Primase fragment of primase-helicase protein 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009382   Gene: ENSSARG00000010379   Transcript: ENSSART00000010374
Sequence length 680
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_983:15160:19471:1 gene:ENSSARG00000010379 transcript:ENSSART00000010374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRGRHPLRVLLPRCEWMARRGLPRSLGPGPPRRRYRKEALPALDGPALPVTTTEIRQY
LRAHGIPFQDGHSCLRAPSPFVGDAQLQDQAGAPASSSLFIDKTTGRFLCMISLAEGSWE
DFQASVEGRGDGAREGLLLGESPEAQDSEEVLRIWERAVPLWDLPEQEEAQLARVMFGLT
KVTDDTLRRFSVRYLRPARSLVFPWFFPGSMRLRGLKLLGAESQGEEVRYVETTIPRPGA
YRNLFGLPLIGRRDVELVLTSGELDSLALSQSTGLPTLALPRGTACLPPALLPYLEQFRR
IVLWLGDDLRSWEAAKLFARKLNPKRCSLVRPGDKQPRPLEALNQGLNLSRILRTALPAW
HKSIVSFRQLREEVLGELSNVEQAAGIRWSRFPDLNRLLKGHRKGELTVFTGPTGSGKTT
FISEYALDLCTQGVNTLWGSFEISNVRLARVMLTQFAVGRLEEQLDKYDEWADRFEDLPL
YFMTFHGQQSIRTVIDTMQHAVYVYDICHVVIDNLQFMMGHEQLSSDRIAAQDYIVGAFR
KFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKXXXXXXXXXXXXXXXXXXXPGKRYL
QVSKNRFDGDVGVFPLEFNKSSLTFSIPPKSKARLKKIKDDNGLVTKKPSAGKKGASSQN
LEAGSSPAPNPYPVSSRPSR
Download sequence
Identical sequences ENSSARP00000009382 ENSSARP00000009382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]