SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009951 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSARP00000009951
Domain Number - Region: 5-53
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00418
Family Cgl1923-like 0.022
Further Details:      
 
Domain Number - Region: 74-107
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 0.0262
Family delta-Endotoxin (insectocide), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009951   Gene: ENSSARG00000011040   Transcript: ENSSART00000011027
Sequence length 145
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2246:9746:12031:-1 gene:ENSSARG00000011040 transcript:ENSSART00000011027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAVILLHTFWGVVFFD
ACERRRYWALGLVVSSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFVTAGGSLRSIQ
RSLSCRRQDDSRVMVYSALRIPPED
Download sequence
Identical sequences ENSSARP00000009951 ENSSARP00000009951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]