SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010402 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010402
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000222
Family Cgl1923-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010402   Gene: ENSSARG00000011517   Transcript: ENSSART00000011514
Sequence length 244
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2780:574:23656:1 gene:ENSSARG00000011517 transcript:ENSSART00000011514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAVSVGNVGQLAIDLIISTLDMCKIGYFYTDCLVPMVGNNPYATAEENSTELSINIEXXX
XXXXXXXXXXLRSIFIKFKSKSFCEKLLSWVKSSNFAQVVVLSSSHSYHCNDLQLGGTPF
RYSYTPSTKKNVQNKIKSLNWTEMERSPSIPKKADSESCIRIPGGGITNTXXXXXCSKEI
PMVILLKFVSGDIPDALGLXXXXXXXXXXXXXXSKDDPTTSTVPWKMPSSWRLLFGSGLP
PALF
Download sequence
Identical sequences ENSSARP00000010402 ENSSARP00000010402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]