SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005689 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005689
Domain Number 1 Region: 11-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-32
Family G proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000445
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005689   Gene: ENSSARG00000006293   Transcript: ENSSART00000006273
Sequence length 278
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_3653:9957:20678:-1 gene:ENSSARG00000006293 transcript:ENSSART00000006273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAXXXXXXXXXXXXX
XXXXXXXXDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVP
KILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCDFNITESFTELARTVLLRHGM
DRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPMALRSHLKSFSMANGLNARMMHGRS
YSLATGPSHKRGSFCKARASRAPRSPPRHCARSSCRVS
Download sequence
Identical sequences ENSSARP00000005689 ENSSARP00000005689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]