SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006017 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006017
Domain Number 1 Region: 182-274
Classification Level Classification E-value
Superfamily TAFH domain-like 4.58e-33
Family TAFH domain-like 0.0000288
Further Details:      
 
Domain Number 2 Region: 586-633
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000136
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006017   Gene: ENSSARG00000006618   Transcript: ENSSART00000006631
Sequence length 794
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3638:436:108338:1 gene:ENSSARG00000006618 transcript:ENSSART00000006631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMVTQVAPGSALPKMGGSPGLPAPQIVTVKAPNTTIQLPASLQLPPGTVLIKSNSGQLM
LVSPQQAVTRTETASNIASRPAVPTNTQTVKICTVPNSGSQVIKKVAVAPVNKLPQIGTT
VVTTVPKSSSVQTVAVPTNVVTVTPVKPLTTVTNLKSSSLGASSTPANEAKVKIATAQAN
LTPTMLENVKKCKNFLAMLIKLACSGSQSPEMGKNVKKLVEQLLDAKIEAEEFTKQLYVE
LKSSPQPHLVPFLKKVYPALRQLMPNSQSFIQQCVQQTSREVVIATCTATVTPPPVVTTT
ISSTQGEKSLIVSGAAPPRTVSVQTLNPGAGLVGAKTGVVTLDSVGSATVPAGTATGTML
VQTPKSLMTSIQNTVKAVALQPENPVVSVAPVTLTLPSVTFGETSAAAICLPSMKPVVFY
SDHIKPVIGAPVQIKLSHPGPILSQPAGIPQAVKVKQLFSLFQVVQQPSGGITKQVTTLS
HSSALTVQKSGPKMPVTTAIPTSQFPPVSILKQITLPGNKLLSFQAPPIQKNKIKENGTV
SFRDEDDINDVTSMAGVNLNEENSCILATNSELVGRLVQSCKDEPFLFIGALQKRILDIG
KKHDITELNSDAVNLISHATQERLRGLLEKLTAIAQHRMTTYKASENYILSSDTRSQLKF
LEKLDQLEKQRKDLEEREMLLKAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGLKDNFLASGTSSLTATKQLLRPRITRVCLRDLIFCMEQER
EMKYSRALYLALLK
Download sequence
Identical sequences ENSSARP00000006017 ENSSARP00000006017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]