SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376286584|ref|YP_005159150.1| from Corynebacterium diphtheriae BH8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376286584|ref|YP_005159150.1|
Domain Number 1 Region: 401-421,463-711
Classification Level Classification E-value
Superfamily HAD-like 6.31e-55
Family Meta-cation ATPase, catalytic domain P 0.00027
Further Details:      
 
Domain Number 2 Region: 207-304
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.75e-25
Family Calcium ATPase, transduction domain A 0.0039
Further Details:      
 
Domain Number 3 Region: 150-208,305-396
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000118
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376286584|ref|YP_005159150.1|
Sequence length 744
Comment Cu2+-exporting ATPase [Corynebacterium diphtheriae BH8]
Sequence
MSTPHHSGDHHGDHPAPETDHTHHPDHASHEHHADPDTHGQAMPHDHPHSALDEDHHVHG
HGEHAGHSTAMFRDRFWWSLILSIPVVIFSPMVAHLLGYHLPAFPGSTWIPPVLGTIIFV
YGGTPFLKGGWKELKSRQPGMMLLIAMAITVAFVASWVTTLGLGGFELDFWWELALLVTI
MLLGHWLEMSALGAASSALDALAALLPDEAEKVIDGTTRTVAISELVVDDVVLVRAGARV
PADGTILDGAAEFDEAMITGESRPVFRDTGDKVVAGTVATDNTVRIRVEATGGDTALAGI
QRMVADAQESSSRAQALADRAAALLFWFALISALITAVVWTIIGSPDDAVVRTVTVLVIA
CPHALGLAIPLVIAISSERAAKSGVLIKDRMALERMRTIDVVLFDKTGTLTEGAHAVTGV
AAAVGVTEGELLALAAAAEADSEHPVARAIVAAAAAHPEASRRQIRATGFSAASGRGVRA
TVDGAEILVGGPNMLREFNLTTPAELTDTTSAWTGRGAGVLHIVRDGQIIGAVAVEDKIR
PESRAAVKALQDRGVKVAMITGDAQQVAQAVGQDLGIDEVFAEVLPQDKDTKVTQLQDRG
LSVAMVGDGVNDAPALTRADVGIAIGAGTDVAMESAGVVLASDDPRAVLSMIELSQASYR
KMIQNLIWASGYNILAVPLAAGVLASIGFVLSPAVGAILMSASTIVVALNAQLLRRIDLD
PAHLAPTESKEEHTTPTPASTAVH
Download sequence
Identical sequences U7LB08
gi|376286584|ref|YP_005159150.1| gi|376283556|ref|YP_005156766.1| WP_014316104.1.37117 WP_014316104.1.55111 WP_014316104.1.57737 WP_014316104.1.57961 WP_014316104.1.63519 WP_014316104.1.70128 WP_014316104.1.79887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]