SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL120W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL120W
Domain Number 1 Region: 60-170
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.22e-37
Family Frataxin-like 0.000000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YDL120W   Gene: YDL120W   Transcript: YDL120W
Sequence length 174
Comment pep:known chromosome:R64-1-1:IV:245923:246447:1 gene:YDL120W transcript:YDL120W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVNTFQKRFVESSTDGQV
VPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYV
INKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ
Download sequence
Identical sequences A0A0L8VSF0 A0A250W9Q2 A6ZXL0 B3LH10 B5VFE8 C7GJJ6 C8Z6I3 G2WC42 N1P7K6 Q07540
YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YDL120W YFH1_YEAST SCRT_00614 NP_010163.1.97178 YDL120W YDL120W tr|A6ZXL0|A6ZXL0_YEAS7 YDL120W YDL120W YDL120W YDL120W YDL120W 4932.YDL120W YDL120W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]