SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOL060C from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL060C
Domain Number 1 Region: 247-383
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000232
Family CBS-domain pair 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YOL060C   Gene: YOL060C   Transcript: YOL060C
Sequence length 706
Comment pep:known chromosome:EF4:XV:214017:216137:-1 gene:YOL060C transcript:YOL060C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLPLRSRSRSGAPHWVYIILYHIFTIPKIYSLPLLSGSHVLNSRDVADSGHSVGDEAS
VTTYYIISIILVLLGGVFAGLTLGLMGQDEVYLKVISTSGSNSEKKLAKRVLDLISRGKH
WVLVTLLLSNVITNETLPIVLDRCLGGGWQAVVSSTILIVIFGEIIPQSVCVKYGLQVGA
FFCPFVLVLMYLMYPVAYPIATLLDYMLGEDHGTMYKKSGLKTLVTLHRTMGVERLTKDE
VTIISAVLDLKAKRVEEIMTPIENVFTMSADTILDDKTVEKIFNSGFSRIPIFLPNEPNN
FIGMLLVRVLISYDPDDCLPISHFPLATLPETSPNTSCLNILNYFQEGKAHMCVVSKEPG
SSHGAIGVLTLEDVIEELIGEEIVDESDVFVDMHQHIMRQQPGPLSKRHITSYLHHLYTS
SHKEHKAADQADESSPLLSPSNSNHPSEHPQQDLNNKSWKQKSNDGYDRSNAVLSPTPQV
TEHGTIIPSNLASNPLNVNKSFVTIKKPANVPKIITTHTPHSSKEPSPAPHSNDKSLSAE
EQQLLSDHAELSRQAVLHTQRSGQPTQVTTSTKTTRNSPDSISIPNSGANHGNENQNVTI
STSYQNTKNGIVESVITVKGVPKTIIGPAKDWDESKSEYGNENINQENSNRSDDRESSSS
NASLFSSIKNKFKNENANNNDRSNFTDSLSRTSNYDANGSSSTIKR
Download sequence
Identical sequences N1NX85 Q12296
YOL060C 4932.YOL060C 2267S YOL060C YOL060C NP_014581.1.97178 YOL060C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]