SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78046595|ref|YP_362770.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046595|ref|YP_362770.1|
Domain Number 1 Region: 10-371
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.19e-104
Family FMN-linked oxidoreductases 0.00000000622
Further Details:      
 
Domain Number 2 Region: 342-528
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000116
Further Details:      
 
Domain Number 3 Region: 469-527,563-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.65e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78046595|ref|YP_362770.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSPATGPSALSFPHLFTPLDLGFTQLRNRVLMGSMHTGLEDRARDFPRLAAYFAERAAGG
VGLIVTGGFSPNVVGWLKPFGGKLSWPWEVRPHRQVTRAVHEHGAKICLQLLHAGRCAYH
PLSVAPSRLKAPINPFTPRALSAGAVDRQIAAYARAARLAREAGYDGVEVMGSEGYLINE
FTAARTNRRSDAWGGDASKRMRFAVEIVRRIREACGPDFIIIYRLSLVDLVEDGNQWQEI
LAQAQAIEAAGATIINSGIGWHEARIPTIATSVPRAAFVGVTAKLKPHLRIPVVATNRIN
MPEVAERILADGAADMVSLARPLLADPQWTNKARAGQSHTINTCIACNQACLDHVFDNKL
ASCLVNPRAAHETELNYTPTATPKRIAVVGAGPAGLACATVAAERGHRVTLFEASDAIGG
QFNVARRIPGKEEFNETLRYFGHRIEATGVQLRLNTPVQAADLKDFDEVVLATGIEPRKV
DFPGADHPMVVSYLDVVLGRHVAADKVAIIGAGGIGFDVGEFLVHTGQSPALDPQRWMAE
WGVDPNFEARGALTKPQPERAARQVWLLQRSSGKPGARLGKTTGWIHRATLKAKGVKMLG
GVEYLGVDDAGLRIRVEGSEQLLDVGTVVVCAGQEPRRELLAALQANGQQPHLIGGADVA
AELDAKRAINQASRLAATL
Download sequence
Identical sequences Q3BWU3
WP_011346552.1.100156 WP_011346552.1.10442 WP_011346552.1.13735 WP_011346552.1.199 WP_011346552.1.21317 WP_011346552.1.23534 WP_011346552.1.27112 WP_011346552.1.29361 WP_011346552.1.39371 WP_011346552.1.40690 WP_011346552.1.46449 WP_011346552.1.46677 WP_011346552.1.55770 WP_011346552.1.60785 WP_011346552.1.61221 WP_011346552.1.64411 WP_011346552.1.66420 WP_011346552.1.67180 WP_011346552.1.67877 WP_011346552.1.772 WP_011346552.1.78066 WP_011346552.1.81489 WP_011346552.1.8544 WP_011346552.1.89212 WP_011346552.1.89360 WP_011346552.1.99285 gi|78046595|ref|YP_362770.1| 316273.XCV1039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]