SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78049536|ref|YP_365711.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049536|ref|YP_365711.1|
Domain Number 1 Region: 112-355
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.19e-67
Family D-glucarate dehydratase-like 0.0000052
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.89e-30
Family Enolase N-terminal domain-like 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78049536|ref|YP_365711.1|
Sequence length 365
Comment chloromuconate cycloisomerase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKITGFRLGMLRVPLKTPFKTAVRTVQAIEDVVVLLQTDSGHIGYGAAPATAPITGDTHG
SIIAAIEHCIGPKLIDQYVADLNRLCGRVQHAIERNTSAKAAVEIALYDLWAQAFGAPLY
RLLGGGTPRITTDITISADAIDTMVAQAQAALARGYRALKIKVGKDIESDVERVTAIHAA
VAGRASLRLDANQGWTPKQAVRTMRTLEDGGIALELLEQPVKAADLDGLAFVTARIDTPV
MADESVFSPTQVIELIQRRAADIINIKLMKTGGLSNAIRIADIAGVYGLPCMIGCMIESS
ISVAAAVHLAVAKADSITLADLDAPALGQFDPTEGGAHFDEAQIHIDDSPGLGIRRIRGL
ELLPA
Download sequence
Identical sequences Q3BNF2
316273.XCV3980 WP_011348823.1.100156 WP_011348823.1.10442 WP_011348823.1.11230 WP_011348823.1.13735 WP_011348823.1.199 WP_011348823.1.21303 WP_011348823.1.21317 WP_011348823.1.2259 WP_011348823.1.23534 WP_011348823.1.27112 WP_011348823.1.29361 WP_011348823.1.3003 WP_011348823.1.37942 WP_011348823.1.39371 WP_011348823.1.40690 WP_011348823.1.43396 WP_011348823.1.44794 WP_011348823.1.46449 WP_011348823.1.46677 WP_011348823.1.49886 WP_011348823.1.55770 WP_011348823.1.60785 WP_011348823.1.64411 WP_011348823.1.66420 WP_011348823.1.67180 WP_011348823.1.67877 WP_011348823.1.772 WP_011348823.1.79359 WP_011348823.1.81489 WP_011348823.1.8544 WP_011348823.1.89212 WP_011348823.1.89360 WP_011348823.1.94946 WP_011348823.1.99285 gi|78049536|ref|YP_365711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]