SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78049843|ref|YP_366018.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049843|ref|YP_366018.1|
Domain Number 1 Region: 184-431
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.11e-69
Family D-glucarate dehydratase-like 0.000000000617
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.11e-37
Family Enolase N-terminal domain-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78049843|ref|YP_366018.1|
Sequence length 440
Comment mandelate racemase/muconate lactonizing enzyme [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MRTIIALETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAADDLAGYGLVFTIGRGN
DVQTAAVAALAEHVIGLSVDEVIADLGAFARRLTNDSQLRWLGPEKGVMHMAIGAVINAA
WDLAARAAKKPLWRFIAELTPEQLVDTIDFRYLTDALTRDEALAILRAAQPQRAQRIARL
IEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVGANVRDDIRRCRLAREAIG
PDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGIAPVPVSTG
EHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLAAKFNVRVFPHAGGVGLCEL
VQHLAMADFVAITGKMEDRAIEFVDHLHQHFLDPVRIRHGRYLAPEAAGFSAEMHAASIA
EFSYPGGRFWVEDLAASAKT
Download sequence
Identical sequences Q3BMJ5
WP_011349048.1.100156 WP_011349048.1.10442 WP_011349048.1.11230 WP_011349048.1.13735 WP_011349048.1.199 WP_011349048.1.21303 WP_011349048.1.21317 WP_011349048.1.2259 WP_011349048.1.23534 WP_011349048.1.27112 WP_011349048.1.29361 WP_011349048.1.3003 WP_011349048.1.331 WP_011349048.1.37942 WP_011349048.1.39371 WP_011349048.1.40690 WP_011349048.1.43396 WP_011349048.1.44794 WP_011349048.1.46449 WP_011349048.1.46677 WP_011349048.1.49886 WP_011349048.1.55770 WP_011349048.1.60785 WP_011349048.1.64411 WP_011349048.1.66420 WP_011349048.1.67180 WP_011349048.1.67877 WP_011349048.1.75734 WP_011349048.1.772 WP_011349048.1.79359 WP_011349048.1.81489 WP_011349048.1.8544 WP_011349048.1.89212 WP_011349048.1.89360 WP_011349048.1.94946 WP_011349048.1.99285 316273.XCV4287 gi|78049843|ref|YP_366018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]