SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78049891|ref|YP_366066.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049891|ref|YP_366066.1|
Domain Number 1 Region: 115-401
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.67e-70
Family D-glucarate dehydratase-like 0.00026
Further Details:      
 
Domain Number 2 Region: 26-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.69e-31
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78049891|ref|YP_366066.1|
Sequence length 419
Comment starvation sensing protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSQTSDSPAPLQGSARDREIVEARVIVTCPGRNFVTLKIRTRSGITGLGDATLNGRELAV
AAYLQEHLMPNLIGRDAGRIEDIWQFFYRGAYWRRGPVTMSAIAAVDVALWDILGKMAGM
PLYQLLGGRSREGALVYGHANGRDIAETSDEVGRFREMGFIAIRAQCGVPGIKKTYGISV
GGKPYEPAESELPTETVWSTPRYLGVVPKLFEQLRNDHGDAIELLHDAHHRLTPIEAARL
GRDLEPYRLFWLEDATPAENQRAFEIIRQHTVTPLAVGEVFNSIWDCKHLIEQQLIDYIR
TTIVHAGGITHVRRLADFAALHQVRTGFHGATDLSPVCMGAALHFDTWVPNFGIQEYMFH
SDEANAVFPHDYQFRDGRLHCGETPGHGVDIDEALAAKYPYVPKQLPIARLEDGAMWDW
Download sequence
Identical sequences Q3BME7
316273.XCV4335 gi|78049891|ref|YP_366066.1| WP_011349089.1.100156 WP_011349089.1.10442 WP_011349089.1.11230 WP_011349089.1.13735 WP_011349089.1.199 WP_011349089.1.21303 WP_011349089.1.21317 WP_011349089.1.2259 WP_011349089.1.23534 WP_011349089.1.27112 WP_011349089.1.29361 WP_011349089.1.3003 WP_011349089.1.37942 WP_011349089.1.39371 WP_011349089.1.40690 WP_011349089.1.43396 WP_011349089.1.44794 WP_011349089.1.46449 WP_011349089.1.46677 WP_011349089.1.49886 WP_011349089.1.55770 WP_011349089.1.60785 WP_011349089.1.64411 WP_011349089.1.66420 WP_011349089.1.67180 WP_011349089.1.67877 WP_011349089.1.75734 WP_011349089.1.772 WP_011349089.1.79359 WP_011349089.1.81489 WP_011349089.1.8544 WP_011349089.1.89212 WP_011349089.1.89360 WP_011349089.1.94946 WP_011349089.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]