SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78049038|ref|YP_365213.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049038|ref|YP_365213.1|
Domain Number 1 Region: 237-281,314-556
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.56e-41
Family CoA transferase alpha subunit-like 0.03
Further Details:      
 
Weak hits

Sequence:  gi|78049038|ref|YP_365213.1|
Domain Number - Region: 28-129,156-273
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 0.00209
Family CoA transferase alpha subunit-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78049038|ref|YP_365213.1|
Sequence length 665
Comment hypothetical protein XCV3482 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MQAARDRLGYSAWMTEHLTDLSAAVERILQRIDGPLRVGAPLGIGKPHRLLNALYAQLKD
TPSRPLAIYTALSLNPPRPGTGLQARFAAPFIARHFGEDFPRLAYVDAMLRDALPAHVQV
EEFYMQSGGLLHSTQAQADYTSLNYTHAAAAVAQRAPNLIVQKVAREPGSTRLSLSCNND
ITQDTLDAVQALGLPRPMLVAEVDPLLPWMGGTAAVDAAFFDLIIDLPGPFPQLFGLPRQ
AVSSVDYAIGLYASALVRDGGTLQIGIGTLADALSHALVLRHTDNATYRRVLHALDPALE
HHPAVQASGGLEPFAVGLYGCSEMLNEGFKQLVDSGVIRRKVHDDLPLMQRIADGSADVA
DHARLAAEGEFMHGAFYLGSPAFYQWLRDLDAPTRAAIGMRRISEINQLYGGNETLNRLK
RKDARFFNSCMMATALGAAVSDGLEDGRIVSGVGGQYNFVAMARALPQARSALMLRATRE
AGAHTASNLRWNYGHTTIPRHLRDLYITEYGIADLRHKTDQDCVLEMAAICDARFQGELL
AQAERSRKLRTAPALPVRAQRNTPRALEQALAPFRRDGSLPDYPLGSDSTKIEQRLLPAL
DWLKGATASTGGKIATVARALLTRQAPGADDVACLQRMALDAPNSLGDRLQARLLTHALR
QTAAP
Download sequence
Identical sequences Q3BPV0
316273.XCV3482 gi|78049038|ref|YP_365213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]