SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|84622662|ref|YP_450034.1| from Xanthomonas oryzae pv. oryzae MAFF 311018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84622662|ref|YP_450034.1|
Domain Number 1 Region: 36-310
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.41e-40
Family Phosphate binding protein-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84622662|ref|YP_450034.1|
Sequence length 349
Comment periplasmic iron-binding protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
Sequence
MRLMWMLVVLLIHGIAYAEPGQVRRFPAQGRVHVQLRVQGSTDLEVFGAVIQDYQRLHPG
TEVIYEDVIAWDIYDHYVHPARDAIKADMLISASMDLQTKLVNDGHALAHRSAQTAALPA
WAQWRHEVFGISYEPVAIVYNTRNLDAARVPRTRRQLLALLRAPDAPLRGKVGTYNVERS
GVGYLFATQDGQVGSIAGALLAALGTNRVALEERTGTLLDRVSRGELLLAYNVLGSYAQA
RIDAGAPLGIVQPQDYTLVALRTAVIPKTAPHALEARRFLDYLLSPRGQQVLSREARLMP
ILQAAGGRGGSAQPPFRPIPLGPGLLVYLDKLKRRQFLEAWRASTQPPR
Download sequence
Identical sequences A0A2K1NL34
WP_011407770.1.100287 WP_011407770.1.101918 WP_011407770.1.10801 WP_011407770.1.11746 WP_011407770.1.12016 WP_011407770.1.12284 WP_011407770.1.13943 WP_011407770.1.15093 WP_011407770.1.16001 WP_011407770.1.17939 WP_011407770.1.19029 WP_011407770.1.19407 WP_011407770.1.19779 WP_011407770.1.20356 WP_011407770.1.21407 WP_011407770.1.22155 WP_011407770.1.22948 WP_011407770.1.2575 WP_011407770.1.29999 WP_011407770.1.3010 WP_011407770.1.32656 WP_011407770.1.34187 WP_011407770.1.34831 WP_011407770.1.38499 WP_011407770.1.39578 WP_011407770.1.40044 WP_011407770.1.40785 WP_011407770.1.41276 WP_011407770.1.42687 WP_011407770.1.42954 WP_011407770.1.43671 WP_011407770.1.44430 WP_011407770.1.45003 WP_011407770.1.4539 WP_011407770.1.47084 WP_011407770.1.48014 WP_011407770.1.49044 WP_011407770.1.49225 WP_011407770.1.49377 WP_011407770.1.51059 WP_011407770.1.52109 WP_011407770.1.53330 WP_011407770.1.537 WP_011407770.1.55471 WP_011407770.1.56638 WP_011407770.1.56661 WP_011407770.1.56997 WP_011407770.1.57225 WP_011407770.1.57350 WP_011407770.1.57864 WP_011407770.1.57935 WP_011407770.1.58736 WP_011407770.1.60363 WP_011407770.1.60953 WP_011407770.1.61774 WP_011407770.1.61876 WP_011407770.1.63306 WP_011407770.1.65775 WP_011407770.1.67359 WP_011407770.1.67821 WP_011407770.1.68588 WP_011407770.1.68727 WP_011407770.1.68760 WP_011407770.1.71791 WP_011407770.1.74787 WP_011407770.1.75518 WP_011407770.1.76491 WP_011407770.1.76573 WP_011407770.1.76801 WP_011407770.1.8070 WP_011407770.1.8269 WP_011407770.1.83077 WP_011407770.1.8313 WP_011407770.1.84104 WP_011407770.1.85262 WP_011407770.1.85266 WP_011407770.1.87020 WP_011407770.1.88561 WP_011407770.1.89095 WP_011407770.1.90241 WP_011407770.1.91866 WP_011407770.1.91997 WP_011407770.1.93038 WP_011407770.1.94601 WP_011407770.1.95101 WP_011407770.1.96729 WP_011407770.1.97155 WP_011407770.1.97395 WP_011407770.1.99258 342109.XOO_1005 gi|84622662|ref|YP_450034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]