SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|84622667|ref|YP_450039.1| from Xanthomonas oryzae pv. oryzae MAFF 311018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84622667|ref|YP_450039.1|
Domain Number 1 Region: 27-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.23e-38
Family Phosphate binding protein-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84622667|ref|YP_450039.1|
Sequence length 259
Comment hypothetical protein XOO_1010 [Xanthomonas oryzae pv. oryzae MAFF 311018]
Sequence
MMRPLWKKVLAAIVAAALLPIAASAQELTVMTSGGFTAAVERLAPQYTRQTGVKVTTLLG
PSMGETPQAIPNRLARGEHADVVIMVGSALQKLIDTGLVAPASRVELADSRIGMVVRSGT
PKPKIDSVEHFKQTLLHADSVAYSDSASGVYIETTLFKKLRIEGPMMAKSKKIPRIPVAT
VVADGSYQLGFQQVAELLPVAGVQFVGKIPEPLQSITRYAAGVPVNAEHPEAAKRLLAYL
QSGDAQAVARVTGLDPASP
Download sequence
Identical sequences A0A0K0GP32 A0A2K1K143 Q5H3V4
gi|188578293|ref|YP_001915222.1| 291331.XOO1113 342109.XOO_1010 360094.PXO_02401 gi|58580736|ref|YP_199752.1| gi|84622667|ref|YP_450039.1| WP_011257955.1.100287 WP_011257955.1.101918 WP_011257955.1.12284 WP_011257955.1.15093 WP_011257955.1.17939 WP_011257955.1.19407 WP_011257955.1.20356 WP_011257955.1.21407 WP_011257955.1.22155 WP_011257955.1.22948 WP_011257955.1.2575 WP_011257955.1.28412 WP_011257955.1.353 WP_011257955.1.39578 WP_011257955.1.40785 WP_011257955.1.41276 WP_011257955.1.43671 WP_011257955.1.45003 WP_011257955.1.47084 WP_011257955.1.48014 WP_011257955.1.49377 WP_011257955.1.51059 WP_011257955.1.52109 WP_011257955.1.53330 WP_011257955.1.56997 WP_011257955.1.57225 WP_011257955.1.57652 WP_011257955.1.57864 WP_011257955.1.57935 WP_011257955.1.60363 WP_011257955.1.63306 WP_011257955.1.65775 WP_011257955.1.71791 WP_011257955.1.73657 WP_011257955.1.76573 WP_011257955.1.8070 WP_011257955.1.8269 WP_011257955.1.8313 WP_011257955.1.84104 WP_011257955.1.87020 WP_011257955.1.87238 WP_011257955.1.89095 WP_011257955.1.90241 WP_011257955.1.91866 WP_011257955.1.93038 WP_011257955.1.96729 WP_011257955.1.97155 WP_011257955.1.97395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]