SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258508662|ref|YP_003171413.1| from Lactobacillus rhamnosus GG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258508662|ref|YP_003171413.1|
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000214
Further Details:      
 
Weak hits

Sequence:  gi|258508662|ref|YP_003171413.1|
Domain Number - Region: 503-561
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 426-482
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 359-421
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258508662|ref|YP_003171413.1|
Sequence length 666
Comment serine/threonine protein kinase [Lactobacillus rhamnosus GG]
Sequence
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AMATSELVHPNIVSIYDVGESHGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHRDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVSIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLSTALSPARAHEAKYVIPKDDLDETRIVPVIPN
GPKPPHDDDDHADQPAEHHSPDGQAKKKRRRWLMIGLSALIVMLILVGIGLVTANQKADV
TVPDLRGMTKTQAKTALTSSRLKVGKYRYTYSTKVDRDLVIDSSPKRQVSVKEGSAVDLI
LSRGQPRITLDNYVGQDYTDAKSDLQKRGVTVKEKVVRTNSVAAGKITAQSIKPGKKVIA
SKTTITFDVAEPIKKVNTAFALRDLTGYTEKSLRDYANEVGLKIVIAQSHSDTVDTGMVI
SQNPAAGTQVHAGDTVNVTISQGPDPDELKTVTKTISIPYQAPASSSTSSDSGSSSGSAS
SSGPTPNGVQVFIGDKTHNINSVNKTFNITADNQVTITLQVNKTYPGSYRVVRDGTVVAQ
EYNITQ
Download sequence
Identical sequences A0A1Y0E0F8 A0A249N1T7 A0A2A5L741
WP_005684373.1.100 WP_005684373.1.100405 WP_005684373.1.101629 WP_005684373.1.14484 WP_005684373.1.15430 WP_005684373.1.23805 WP_005684373.1.32471 WP_005684373.1.33665 WP_005684373.1.36475 WP_005684373.1.37365 WP_005684373.1.42644 WP_005684373.1.4294 WP_005684373.1.51722 WP_005684373.1.57217 WP_005684373.1.57253 WP_005684373.1.62246 WP_005684373.1.62275 WP_005684373.1.62506 WP_005684373.1.63053 WP_005684373.1.63979 WP_005684373.1.68137 WP_005684373.1.72055 WP_005684373.1.73229 WP_005684373.1.7391 WP_005684373.1.76241 WP_005684373.1.78781 WP_005684373.1.80214 WP_005684373.1.8195 WP_005684373.1.93450 WP_005684373.1.95170 WP_005684373.1.96492 WP_005684373.1.9713 gi|258508662|ref|YP_003171413.1| gi|258508662|ref|YP_003171413.1| 568703.LGG_01667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]