SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258507077|ref|YP_003169828.1| from Lactobacillus rhamnosus GG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258507077|ref|YP_003169828.1|
Domain Number 1 Region: 295-314,387-590
Classification Level Classification E-value
Superfamily HAD-like 1.22e-40
Family Meta-cation ATPase, catalytic domain P 0.001
Further Details:      
 
Domain Number 2 Region: 119-204
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.32e-21
Family Calcium ATPase, transduction domain A 0.0039
Further Details:      
 
Domain Number 3 Region: 60-111,205-282
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000994
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258507077|ref|YP_003169828.1|
Sequence length 618
Comment cation transport ATPase [Lactobacillus rhamnosus GG]
Sequence
MRFIQTHKQEAMVIGGVLTAAGLIFSQAWLLVLASLVAGLPIAVNAWEALRYKQISIELL
VTIALVGAVMIGEPIESAVVSFLFLFGDWLEQRSLAKTRSAIQGLAAAAPKTARLLDGTT
IPVGKLAVGDQVRVLAGETVPADGQVISGQANIVEAAITGEPDAKRKQVGATVYSGTQVS
DGTVDIEVEKTGYNTVYQQIIDLIEDAQDAQSPVATFIQKFARWYTPLVLVIALLVGLIS
QNVRLAITILVLGCPGALVIGAPVSNVVGLGFGAKHGILIKGGDVATKLDQIDTVMFDKT
GTLTQGKIRVTTAKYWTADQQRVAAMVAAVEKATAHPLGQALVADLQTKALQKPTDVKVT
RGVGVNARIAGHAISVGNQKILHQPLTADQQADIQQIVASGATLVLVTIDDKLVAAYGLR
DQLRTETPTMLSTLKASGKKTMVLSGDSQAAVEHMMSALPVSQTRGGLLPADKVKAIKAA
QARGEKVMFVGDGINDGPALAQADVGVAMGSGMDVAIDTADVILTNSRLTNLGVLFDLAK
RMNRNIKQNLVIAIGTVALLLSGLLIGLVDMASGMLFHEISILLVIANALRLRHTPRKWQ
NLTAIKVRHPQTVNNENK
Download sequence
Identical sequences A0A180CKX9
568703.LGG_00082 gi|258507077|ref|YP_003169828.1| WP_014568923.1.100 WP_014568923.1.100405 WP_014568923.1.101629 WP_014568923.1.14484 WP_014568923.1.15430 WP_014568923.1.23805 WP_014568923.1.3013 WP_014568923.1.33665 WP_014568923.1.36475 WP_014568923.1.51722 WP_014568923.1.57217 WP_014568923.1.57253 WP_014568923.1.62246 WP_014568923.1.62275 WP_014568923.1.62506 WP_014568923.1.63053 WP_014568923.1.63979 WP_014568923.1.67395 WP_014568923.1.70398 WP_014568923.1.72055 WP_014568923.1.73229 WP_014568923.1.7391 WP_014568923.1.76241 WP_014568923.1.79700 WP_014568923.1.8195 WP_014568923.1.85933 WP_014568923.1.95170 WP_014568923.1.96492 WP_014568923.1.9713 WP_014568923.1.99828 gi|258507077|ref|YP_003169828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]