SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258508796|ref|YP_003171547.1| from Lactobacillus rhamnosus GG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258508796|ref|YP_003171547.1|
Domain Number 1 Region: 432-451,490-735
Classification Level Classification E-value
Superfamily HAD-like 1.12e-52
Family Meta-cation ATPase, catalytic domain P 0.00031
Further Details:      
 
Domain Number 2 Region: 238-335
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 8.63e-21
Family Calcium ATPase, transduction domain A 0.0062
Further Details:      
 
Domain Number 3 Region: 194-239,336-425
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000392
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258508796|ref|YP_003171547.1|
Sequence length 742
Comment copper-translocating P-type ATPase [Lactobacillus rhamnosus GG]
Sequence
MMKKDNMNPSQKMKESANDKGQMQMSHHDQMHAGKMTDMSMDHEHMHQQTDMASMQMSHH
DMGHMAMNHSGMDMHMDHGNMDHGGGHMMHMGNLKQKFWVSLIVMIPVLLLAQFMGMNIH
LGVIELPIVFPGSDWVVLVLSSFLFFYGGWPFLTGAKAELQQRQPAMMTLIAMGITVAYG
YSLYAFLMNNFIAPNGMVMDFFWELATLIVIMLLGHWIEMNAVMAAGNAVEKLAALLPNQ
AHVVHGDHVMDMPLSEVQVGARLRVLAGEQMPADGQVVSGNSSVNESLVTGEAKAIRKAE
GDQVIGGSVNGDGVIEIKVTGTGESGYLSQVMKLVQSAQANKSKAEGMADKVAGWLFYAA
LAVGLLAFFLWLPSGAAVAFERMVTVFIIACPHALGLAIPLVIARSTSIGATNGLLIRNR
QALETVKRAQFILMDKTGTLTEGKFTVAKTIAFAGHDQTQVLSVMAALENHSEHPLATGI
KAAAKQQALKLPDAQNVQVLKGIGLEGEIDGQRYTIVNARYLKDHHLAYDEAQADQLAGA
GNSLAFLIQDDQVLGMVAEGDQLKPSSKSFVTALKQQGITPVMLTGDNHETAKKVADQLG
ITDFQAELKPEDKVAQVEAYQKRGVVMMVGDGVNDAPSLAQADIGVAIGAGTDVAIDTAD
VVLVHSDPADILNFLSLAKATNRKMVQNLWWGAGYNILAIPLAAGILAPVGFILSPAVGA
AIMSLSTIVVALNAMTLHLKRA
Download sequence
Identical sequences gi|258508796|ref|YP_003171547.1| 568703.LGG_01801 gi|258508796|ref|YP_003171547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]