SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258509798|ref|YP_003172549.1| from Lactobacillus rhamnosus GG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258509798|ref|YP_003172549.1|
Domain Number 1 Region: 300-320,357-586
Classification Level Classification E-value
Superfamily HAD-like 2.29e-41
Family Meta-cation ATPase, catalytic domain P 0.0012
Further Details:      
 
Domain Number 2 Region: 113-210
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.84e-24
Family Calcium ATPase, transduction domain A 0.0074
Further Details:      
 
Domain Number 3 Region: 65-111,211-296
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000034
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258509798|ref|YP_003172549.1|
Sequence length 608
Comment heavy metal translocating P-type ATPase [Lactobacillus rhamnosus GG]
Sequence
MKKNWQLMMVLVVSAVALVFAFILKQPLIAQGLITVMGSIIALIMFGGMVKTIRSGNFGV
DLLAITAVVATLAVSQYWAAMIVLLMLTGGDALESYAATKASSELKQLLENAPTTAHRLV
DGHVEDVDVDAVQVGETILVKPQEVVPVDGTVLEGESLVDEASLTGESKPVAKNAGSDIM
SGTINGDSALTVKVTQRAEDSQYQGIIKLVKESEARPAHFVRMADRYAVPFTLVAYVIAG
LGWFLSGDPVRFAQVLVVASPCPLILAAPIAMVSGMSRNSRNGIIVKSGTTLEKLSDART
FAFDKTGTVTRGILKVATVLPQAGFSQDELLNLAASAEGQSTHILARSLTDAVPAADRLP
ASEVSEATSFGVYATVDGHKVKVGKAEFADAKDTLDTTAVYVNVDGQYAGAITFSDQIRP
EAKETMTKLHELNDANLIMISGDQQSIADKVAQEVGIDQVYAEQLPQQKIEVLDNVPKDD
RPVVMVGDGVNDAPSLAIADVGIAMGAHGATAASESADAVVLRDDLAKVAAATLIAKETM
VIAKQSVLIGIAICTGLMLIASFGVIPTIIGAMLQEVVDTVTILYALRARNGLHRQALVD
PVRAEARA
Download sequence
Identical sequences A0A1Y0DXJ4
568703.LGG_02803 WP_014570196.1.100 WP_014570196.1.100405 WP_014570196.1.101629 WP_014570196.1.14484 WP_014570196.1.15430 WP_014570196.1.23805 WP_014570196.1.33665 WP_014570196.1.36475 WP_014570196.1.57253 WP_014570196.1.62246 WP_014570196.1.62275 WP_014570196.1.62506 WP_014570196.1.63053 WP_014570196.1.63979 WP_014570196.1.67395 WP_014570196.1.70398 WP_014570196.1.73229 WP_014570196.1.7391 WP_014570196.1.8195 WP_014570196.1.85933 WP_014570196.1.95170 gi|258509798|ref|YP_003172549.1| gi|258509798|ref|YP_003172549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]