SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:10806 from Saccharomyces bayanus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:10806
Domain Number 1 Region: 69-555
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.85e-53
Family AAT-like 0.0000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:10806
Sequence length 560
Comment YHR137W, Contig c181 1159-2841
Sequence
MYIIGEQVYVLMSTGCGTGLLFQGSCISCFIQLTHIHTQAHTLQHNHIMTAGSIAPLDYA
SLKKKFQPFLSKRVENRHLKSFWNPSEPNDDIIELAGGMPHEKFFPIEAIDLKISKMPFN
ENPKWHDSFTTAHLDLESPGEMPIARSFQYAETKGMPPLLQFTKDMVARINRPAFSDETD
SNWDVILSGGSNDSMYKVFETFCDESTTVMIEEFTFTPAVSNVEATGATVVPIKINLSAD
RETQSVDVDYLSQLLENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQR
HDFLIVEDDPYGYLYFPPFDPENPLENPYQSSSVTTERYLNEFLMKSFLTLDTDARVIRL
ETFSKIFAPGLRLSFIVANKFILEKVLDLADITTRAPSGTSQAIVYSTIKAMAESNMPSS
LPFKELMFESWIQWIMEIASKYNHRKNITLKALYETESYRAGQFSVMEPSAGMFIIIKIN
WANFGKPDDLPQQMDRLDEFLVKNGVKLVLGYKMAVSLDYSMQHSDFLRLTIAYAKDDNQ
LIEASRRIGNGIKEFFENYN
Download sequence
Identical sequences ORFP:10806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]