SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:19624 from Saccharomyces bayanus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:19624
Domain Number 1 Region: 50-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.87e-105
Family Pyridoxal-dependent decarboxylase 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:19624
Sequence length 583
Comment YMR250W, Contig c756 37-1788 reverse complement
Sequence
MLHRHKSKQNKSEGIADQVGRDLAGLQLLSNDIQKSATHQGHPTTKGNTESQGMANKYSV
PKQGLPADLSYELIHNELTLDGNPHLNLASFVNTFTTDQAKKLIHENLAKNLADNDEYPQ
LIELTQRCISMLAQLWHASPAEEPMGCATTGSSEAIMLGGLAMKKRWEHRMQDAGKDISK
PNIIMSSACQVALEKFTRYFEVECRLIPVSSKSHHMLDPESLWDYVDENTIGCFVILGTT
YTGHLENVEEVANVLSQIEAKHSDWSNVDIPIHADGASGGFIIPFGFEKETMKSYGLERW
GFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDEFLLPNELIFKLKYLGGVEETFGLNFSRP
GFQVVHQYFNFVSLGYSGYRAQFQNSLFVARAFSFELLNSSKLPGCFEIVSSIHENIKNN
SVPKKVSEYWEHPQVYKPGVPLVAFKLSKKFHEEYPEIPQAILSSLLRSRGWIIPNYPLP
KATDGSDKKEVLRVVFRTEMKLDLAQLLVVDIENVLTKLIQSYEKVCQHIDALSEQTPER
KSSFIYEMLLALASPQEDIPNPEQTIRKKKLEERTTRNYRGTC
Download sequence
Identical sequences ORFP:19624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]