SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:9301 from Saccharomyces bayanus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:9301
Domain Number 1 Region: 268-553,595-646
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.14e-85
Family IF2B-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:9301
Sequence length 650
Comment YGR083C, Contig c355 430-2382
Sequence
MSESEAKAGVAAPPGKAEQAAPVAATTSGAKKLSNKELKEMKKQEKAAKRAALKQANGMS
IEQQQQQAQIKKEKKQLQREQQQKREQRQKNATKKKESGQNVKKSTLFGHLETTEERRAT
ILAVTSAVSSPRTSRITAAGLMIPVVASALSGSNVLTASSLMPTGPTAAFTPATTAPTSA
TMTVSASSTALSAASTSTATSTPTAIQQEIASSNASDVAKTLASISLEAGEFNVIPGISS
VIPAALEQSFDSSSLVSSVKELLLNKDLIHPSILLLTSHLAHYKIVGSIPRCIAMLEVFQ
IVIKDYQTPKGTTLSRNLTNYLSHQIDLLKKARPLSVTMGNAIRWLKQEISLIDPSTPDK
AAKKDLCEKIGQFAKEKIELADQLIIDNASTQIEDSTTIVTYGSSKVLTELLLHNSIGLK
KNIKVIVVDSRPLFEGRKMAETLRNAGVNVMYALITSLDTIFNMDVDYVFLGAHSILSNG
FLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLINIDYENPV
ERRGNKGALLNQFVKERKLEKKKLEMENKPKGNKIGGKKGSEEENKDVNDEGDNDEKNIL
DGWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA
Download sequence
Identical sequences ORFP:9301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]