SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566002707|ref|YP_008915547.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566002707|ref|YP_008915547.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000481
Family GHMP Kinase, N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 261-302
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000153
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.052
Further Details:      
 
Weak hits

Sequence:  gi|566002707|ref|YP_008915547.1|
Domain Number - Region: 205-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00762
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|566002707|ref|YP_008915547.1|
Sequence length 329
Comment putative protein MTH_830 [Methanobacterium sp. MB1]
Sequence
MIIETPSRLHLTLIDLNGSLGRIDGGVGLTLEKPGLVLEMEESSGGISVEFKNQENLSAK
VMADDEDKIKTSARRMMDHLQLNRGYNFTVHETYLSHSGLGSGTQISLAVGKLISDSVEQ
HLDAPQIASIVGRGGTSGIGVASFAKGGFIVDAGHHQREKPDFLPSSASTASPPPIVARY
DFPQDWKVVLIIPNVEKNISGSKEVNIFKEYCPVPLKEVQQLSHILLMKMMPAVLEKDLD
NFGDSINRIQNIGFKKVENQLQNPIIGEIMQLLRDAGAPGVGMSSFGPTIYAVTDSPRDI
VNVAGDALSEIGGSIIETRAQNSGAVTRY
Download sequence
Identical sequences U6EA54
gi|566002707|ref|YP_008915547.1| WP_023991836.1.96908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]