SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566002820|ref|YP_008915660.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566002820|ref|YP_008915660.1|
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.01e-39
Family GHMP Kinase, N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 183-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.25e-32
Family Mevalonate kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|566002820|ref|YP_008915660.1|
Sequence length 323
Comment Mevalonate kinase [Methanobacterium sp. MB1]
Sequence
MKVSASAPGKAILFGEHSVVYGKPAIAVAVDKRARVTIKEGTNNTEVKIPQLDIEAVIDA
ESRRVTWMNSPQEAGKFDTGILEYIQVALSQLGTPLDGLKVEVDLEIPIGAGLGSSAAIT
VATLAAAARYTQQEVSLEALAHTAHQVELQVQGAASPLDTTVSTQGGFIYFTHEKGAMKI
KPALEMPLVVGYTSKPGNTGVLVEGVRKLRETQPTIVNPILDIMEDLANQARKSIIQGEE
KEVGELMNINQGLLDALGVNTEELSCLVYRARHAGALGSKLTGAGGGGSIIAYCPGKTRE
VLEELESIENAFPVGISSQGVTW
Download sequence
Identical sequences U6EDP4
gi|566002820|ref|YP_008915660.1| WP_023991948.1.96908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]