SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566003342|ref|YP_008916182.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566003342|ref|YP_008916182.1|
Domain Number 1 Region: 33-157
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00000011
Family MJ1460-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|566003342|ref|YP_008916182.1|
Sequence length 182
Comment hypothetical protein MBMB1_1338 [Methanobacterium sp. MB1]
Sequence
MAIQEVRGTFKPELIPKETQGDIDDYEDALHVLMKFMGSMSSALEQVSGRGANAIVYQAG
KRMGHDAAKMLEKTDNLEKAMDEMGEVLGTEFYYRMWKPAGQENYTIEKGDETQVKLLFR
DCVVRQTLRRTGLPQKGPLCYLLYGYMVGAVEEVMDIRGKVDIDHVGPNACLKTLTIKWG
GK
Download sequence
Identical sequences U6EB95
WP_023992470.1.96908 gi|566003342|ref|YP_008916182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]