SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566003960|ref|YP_008916800.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566003960|ref|YP_008916800.1|
Domain Number 1 Region: 118-249
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.46e-34
Family MJ1460-like 0.014
Further Details:      
 
Domain Number 2 Region: 20-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000145
Family ArsR-like transcriptional regulators 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|566003960|ref|YP_008916800.1|
Sequence length 258
Comment ArsR family transcriptional regulator [Methanobacterium sp. MB1]
Sequence
MATTQTKGSIKIFSTQNGVNIIQSPIKAQILSILKEGGQSGSQIVSSTKRSKSTISAHLQ
DLEDAGIIDWIIDPDDRRRKIYFIKSKFLGDVSPNQEIEDHVNTLLEEYVTQSNDPFDFF
RYMFRTIRVALLDEGINIDPILHNAGMKVGKTFYNKLKGEDLNTLIQNIASFWETNNLGH
IEVKSLNPLIIQAYDCFECEDLPKIGKPACAFDSGVLEGIFSNFFKQTVEVEETKCYAQG
DDFCQFIIKPLKQTEKVP
Download sequence
Identical sequences U6EFB1
WP_023993080.1.96908 gi|566003960|ref|YP_008916800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]